
                                  recoder 



Function

   Remove restriction sites but maintain same translation

Description

   recoder scans a given nucleotide sequence for restriction sites. It
   reports single base positions in the restriction pattern which when
   mutated remove the restriction site whilst maintaining the same
   translation (in frame 1 of the input sequence).

   Several restriction enzymes can be specified or alternatively all the
   enzymes in the REBASE database can be investigated. To find out
   whether the single point mutations found by 'recoder', introduce new
   restriction sites, 'silent' should be run on the original sequence.
   ('Silent' searches for silent point mutation sites which maintain the
   same translation.

   The output for 'recoder' is similar to the format used by 'silent'.

Usage

   Here is a sample session with recoder


% recoder 
Remove restriction sites but maintain same translation
Input nucleotide sequence: tembl:x65923
Comma separated enzyme list [all]: EcoRII
Output report [x65923.recoder]: 

   Go to the input files for this example
   Go to the output files for this example

Command line arguments

   Standard (Mandatory) qualifiers:
  [-sequence]          sequence   Nucleotide sequence filename and optional
                                  format, or reference (input USA)
   -enzymes            string     [all] Comma separated enzyme list (Any
                                  string is accepted)
  [-outfile]           report     [*.recoder] Output report file name

   Additional (Optional) qualifiers: (none)
   Advanced (Unprompted) qualifiers:
   -sshow              boolean    [N] Display untranslated sequence
   -tshow              boolean    [N] Display translated sequence

   Associated qualifiers:

   "-sequence" associated qualifiers
   -sbegin1            integer    Start of the sequence to be used
   -send1              integer    End of the sequence to be used
   -sreverse1          boolean    Reverse (if DNA)
   -sask1              boolean    Ask for begin/end/reverse
   -snucleotide1       boolean    Sequence is nucleotide
   -sprotein1          boolean    Sequence is protein
   -slower1            boolean    Make lower case
   -supper1            boolean    Make upper case
   -sformat1           string     Input sequence format
   -sdbname1           string     Database name
   -sid1               string     Entryname
   -ufo1               string     UFO features
   -fformat1           string     Features format
   -fopenfile1         string     Features file name

   "-outfile" associated qualifiers
   -rformat2           string     Report format
   -rname2             string     Base file name
   -rextension2        string     File name extension
   -rdirectory2        string     Output directory
   -raccshow2          boolean    Show accession number in the report
   -rdesshow2          boolean    Show description in the report
   -rscoreshow2        boolean    Show the score in the report
   -rusashow2          boolean    Show the full USA in the report
   -rmaxall2           integer    Maximum total hits to report
   -rmaxseq2           integer    Maximum hits to report for one sequence

   General qualifiers:
   -auto               boolean    Turn off prompts
   -stdout             boolean    Write standard output
   -filter             boolean    Read standard input, write standard output
   -options            boolean    Prompt for standard and additional values
   -debug              boolean    Write debug output to program.dbg
   -verbose            boolean    Report some/full command line options
   -help               boolean    Report command line options. More
                                  information on associated and general
                                  qualifiers can be found with -help -verbose
   -warning            boolean    Report warnings
   -error              boolean    Report errors
   -fatal              boolean    Report fatal errors
   -die                boolean    Report dying program messages

Input file format

   recoder reads a normal nucleic acid sequence USA.

  Input files for usage example

   'tembl:x65923' is a sequence entry in the example nucleic acid
   database 'tembl'

  Database entry: tembl:x65923

ID   X65923; SV 1; linear; mRNA; STD; HUM; 518 BP.
XX
AC   X65923;
XX
DT   13-MAY-1992 (Rel. 31, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 11)
XX
DE   H.sapiens fau mRNA
XX
KW   fau gene.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia
;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-518
RA   Michiels L.M.R.;
RT   ;
RL   Submitted (29-APR-1992) to the EMBL/GenBank/DDBJ databases.
RL   L.M.R. Michiels, University of Antwerp, Dept of Biochemistry,
RL   Universiteisplein 1, 2610 Wilrijk, BELGIUM
XX
RN   [2]
RP   1-518
RX   PUBMED; 8395683.
RA   Michiels L., Van der Rauwelaert E., Van Hasselt F., Kas K., Merregaert J.;
RT   " fau cDNA encodes a ubiquitin-like-S30 fusion protein and is expressed as
RT   an antisense sequences in the Finkel-Biskis-Reilly murine sarcoma virus";
RL   Oncogene 8(9):2537-2546(1993).
XX
DR   H-InvDB; HIT000322806.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..518
FT                   /organism="Homo sapiens"
FT                   /chromosome="11q"
FT                   /map="13"
FT                   /mol_type="mRNA"
FT                   /clone_lib="cDNA"
FT                   /clone="pUIA 631"
FT                   /tissue_type="placenta"
FT                   /db_xref="taxon:9606"
FT   misc_feature    57..278
FT                   /note="ubiquitin like part"
FT   CDS             57..458
FT                   /gene="fau"
FT                   /db_xref="GDB:135476"
FT                   /db_xref="GOA:P35544"
FT                   /db_xref="GOA:P62861"
FT                   /db_xref="HGNC:3597"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35544"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62861"
FT                   /protein_id="CAA46716.1"
FT                   /translation="MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLA
G
FT                   APLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKT
G
FT                   RAKRRMQYNRRFVNVVPTFGKKKGPNANS"
FT   misc_feature    98..102
FT                   /note="nucleolar localization signal"
FT   misc_feature    279..458
FT                   /note="S30 part"
FT   polyA_signal    484..489
FT   polyA_site      509
XX
SQ   Sequence 518 BP; 125 A; 139 C; 148 G; 106 T; 0 other;
     ttcctctttc tcgactccat cttcgcggta gctgggaccg ccgttcagtc gccaatatgc        6
0
     agctctttgt ccgcgcccag gagctacaca ccttcgaggt gaccggccag gaaacggtcg       12
0
     cccagatcaa ggctcatgta gcctcactgg agggcattgc cccggaagat caagtcgtgc       18
0
     tcctggcagg cgcgcccctg gaggatgagg ccactctggg ccagtgcggg gtggaggccc       24
0
     tgactaccct ggaagtagca ggccgcatgc ttggaggtaa agttcatggt tccctggccc       30
0
     gtgctggaaa agtgagaggt cagactccta aggtggccaa acaggagaag aagaagaaga       36
0
     agacaggtcg ggctaagcgg cggatgcagt acaaccggcg ctttgtcaac gttgtgccca       42
0
     cctttggcaa gaagaagggc cccaatgcca actcttaagt cttttgtaat tctggctttc       48
0
     tctaataaaa aagccactta gttcagtcaa aaaaaaaa                               51
8
//

Output file format

  Output files for usage example

  File: x65923.recoder

########################################
# Program: recoder
# Rundate: Sun 15 Jul 2007 12:00:00
# Commandline: recoder
#    -sequence tembl:x65923
#    -enzymes EcoRII
# Report_format: table
# Report_file: x65923.recoder
########################################

#=======================================
#
# Sequence: X65923     from: 1   to: 518
# HitCount: 34
#
# KEY:
# Dir: Direction (Rev for reverse complement)
# EnzymeName: Enzyme name
# RS-Pattern: Restriction enzyme recognition site pattern
# Base-Posn: Position of base to be mutated
# AAs: Amino acid. Original sequence(.)After mutation
# Mutation: The base mutation to perform
#
# Creating silent mutations
#
#=======================================

  Start     End Dir    EnzymeName RS-Pattern Base-Posn    AAs Mutation
     77      81 .      EcoRII     CCWGG             78    P.P     C->G
     77      81 .      EcoRII     CCWGG             78    P.P     C->A
     77      81 .      EcoRII     CCWGG             78    P.P     C->T
     77      81 .      EcoRII     CCWGG             79    R.R     A->C
     77      81 .      EcoRII     CCWGG             81    R.R     G->A
    107     111 .      EcoRII     CCWGG            108    A.A     C->G
    107     111 .      EcoRII     CCWGG            108    A.A     C->A
    107     111 .      EcoRII     CCWGG            108    A.A     C->T
    107     111 .      EcoRII     CCWGG            109    R.R     A->C
    107     111 .      EcoRII     CCWGG            111    R.R     G->A
    182     186 .      EcoRII     CCWGG            183    S.S     C->G
    182     186 .      EcoRII     CCWGG            183    S.S     C->A
    182     186 .      EcoRII     CCWGG            183    S.S     C->T
    197     201 .      EcoRII     CCWGG            198    P.P     C->G
    197     201 .      EcoRII     CCWGG            198    P.P     C->A
    197     201 .      EcoRII     CCWGG            198    P.P     C->T
    248     252 .      EcoRII     CCWGG            249    P.P     C->G
    248     252 .      EcoRII     CCWGG            249    P.P     C->A
    248     252 .      EcoRII     CCWGG            249    P.P     C->T
    293     297 .      EcoRII     CCWGG            294    P.P     C->G
    293     297 .      EcoRII     CCWGG            294    P.P     C->A
    293     297 .      EcoRII     CCWGG            294    P.P     C->T
     81      77 Rev    EcoRII     CCWGG             79    P.P     T->G
     81      77 Rev    EcoRII     CCWGG             79    P.P     T->C
    111     107 Rev    EcoRII     CCWGG            109    P.P     T->G
    111     107 Rev    EcoRII     CCWGG            109    P.P     T->C
    186     182 Rev    EcoRII     CCWGG            184    P.P     A->G
    186     182 Rev    EcoRII     CCWGG            184    P.P     A->C
    201     197 Rev    EcoRII     CCWGG            199    P.P     A->G
    201     197 Rev    EcoRII     CCWGG            199    P.P     A->C
    252     248 Rev    EcoRII     CCWGG            250    P.P     A->G
    252     248 Rev    EcoRII     CCWGG            250    P.P     A->C
    297     293 Rev    EcoRII     CCWGG            295    P.P     A->G
    297     293 Rev    EcoRII     CCWGG            295    P.P     A->C

#---------------------------------------
#---------------------------------------

#---------------------------------------
# Total_sequences: 1
# Total_hitcount: 34
#---------------------------------------

Data files

   EMBOSS data files are distributed with the application and stored in
   the standard EMBOSS data directory, which is defined by the EMBOSS
   environment variable EMBOSS_DATA.

   To see the available EMBOSS data files, run:

% embossdata -showall

   To fetch one of the data files (for example 'Exxx.dat') into your
   current directory for you to inspect or modify, run:

% embossdata -fetch -file Exxx.dat

   Users can provide their own data files in their own directories.
   Project specific files can be put in the current directory, or for
   tidier directory listings in a subdirectory called ".embossdata".
   Files for all EMBOSS runs can be put in the user's home directory, or
   again in a subdirectory called ".embossdata".

   The directories are searched in the following order:
     * . (your current directory)
     * .embossdata (under your current directory)
     * ~/ (your home directory)
     * ~/.embossdata

   The EMBOSS REBASE restriction enzyme data files are stored iin
   directory 'data/REBASE/*' under the EMBOSS installation directory.

   These files must first be set up using the program 'rebaseextract'.
   Running 'rebaseextract' may be the job of your system manager.

   The data files are stored in the REBASE directory of the standard
   EMBOSS data directory. The names are:
     * embossre.enz Cleavage information
     * embossre.ref Reference/methylation information
     * embossre.sup Supplier information

   The column information is described at the top of the data files

   The reported enzyme from any one group of isoschizomers (the
   prototype) is specified in the REBASE database and the information is
   held in the data file 'embossre.equ'. You may edit this file to set
   your own preferred prototype, if you wish.

   The format of the file "embossre.equ" is
   Enzyme-name Prototype-name

   i.e. two columns of enzyme names separated by a space. The first name
   of the pair of enzymes is the name that is not preferred and the
   second is the preferred (prototype) name.

Notes

   None.

References

   None.

Warnings

   None.

Diagnostic Error Messages

   None.

Exit status

   It always exits with status 0.

Known bugs

   None.

See also

   Program name                       Description
   redata       Search REBASE for enzyme name, references, suppliers etc
   remap        Display sequence with restriction sites, translation etc
   restover     Find restriction enzymes producing specific overhang
   restrict     Finds restriction enzyme cleavage sites
   showseq      Display a sequence with features, translation etc
   silent       Silent mutation restriction enzyme scan

   silent does the opposite to recoder. silent finds sites where a
   restriction enzyme site can be introduced without changing the
   translation in frame 1 of the sequence. recoder finds sites where a
   restriction enzyme site can be removed without changing the
   translation in frame 1 of the sequence.

Author(s)

   Tim Carver (tcarver  rfcgr.mrc.ac.uk)
   MRC Rosalind Franklin Centre for Genomics Research Wellcome Trust
   Genome Campus, Hinxton, Cambridge, CB10 1SB, UK

History

   Written (January 2001) - Tim Carver

   Renamed from recode to recoder 16 May 2001 as the old name clashed
   with a common UNIX print utility:
   http://www.iro.umontreal.ca/contrib/recode/HTML/

Target users

   This program is intended to be used by everyone and everything, from
   naive users to embedded scripts.

Comments

   None
