.Qinput ,K \Q;88@L0P pZ\  Mp0W4  Dp4`P& X FjEZTimed out.P pZ "pc4W p P TW QW NW Zspack ,K \Q;`PQPApL<X ( 0 X萟0,"0 00 0 0 ,Y 0H  0IY$0P P P* Jx(` j0 6X` ? @\0 0? T0 `  +C0 0 ? K:0? 20 *0 0)\ LH 84P!00 1Z$,@dopar,e[ m[o[ s[0@2+0  K #0  ˰ #chk1 ,K \P; @?Zchk20P  R   0 Rchk3@,0  ["  B"+!"  B"+Qack ,K \RP;? @YZack1 ,K \?P;0@j0 @@YZnack ,K \+P;? NZresend ,K \P;PT`@@V,p@(%(P}) (Pl`@VP )0H %1PZ PZ  Zerrpkt ,K \O;@>7( EM? 0Zscmd ,K \O;@$L8@ $3Zsrinit ,K \O;$8 pR Znxtpkt ,K \O;@匸@OZsigint ,K \O;9ZUser typed rpack ,K \|O;@P`L3pP 0 / 2 ? T0TZrpack: inlin0 2p0rpack: inlin ok, recpktp P WpWQZ0/2P0/2 p0 p爰 P entering rpack with irpack starting at iP PQZ @0 / 20p P pkt len PQZ @0 / ~21 p[rpack: n[QZ 0 / d2SP IP rpack: typeNP| @0@ 0/G2 0/B20/=2Xh"Q0[ rpack: bctu pbl data length0[Z p X0, 2 X&L0 / 2`[ packet chk chk[j]t[QZ 0# p0 X0 1 X  chk array, jP Y Y0 Yt X  P TP 0/10/14 QA/QZ<rpack: chk should be  ?=C0 0? hP 0 / 10/~1 P Pv 0/m15 Q/QZ= xchk[0]= xchk[1] bct2's don't compare ( W 0+0 0 ?=C0 0? P 0,/,810*/*210(/(,1 P [[ 0/1,7 Q.QZ= xchk[0]= xchk[1]= xchk[2] bct3's don't compare&7 .Zinchr 1,K \`M;P&@0/0T0ZL P@0/00Zinchr ttinc after parityinlin ,K \9M; nPwL 0/00/0\PLPp`HP* I!inlin: speed maxt`0/0Vp inlin inchrV 0Pp V U W 0    &PPp 0 a00/\0UZP(WZ8,Zinlin timeouts( KArthur-Kermit functions (based on C-Kermit 4C(039)) 19 Dec 85encstr ,K \L;@0ppP`px@pP`x@Z dencode q,K \L;@0尰[g Lx T(  ^RpZ|^[YpP TT H P@ ( P  ?\[$<0 PT`pZ|[ڈP 夰  P縰 İ ܰP  ‰d! R [ P@ 4Q4 @ @@ QQ Ppp|a P@@$谟 Q ذPa嬱  Pı[ ̱ Q Pa  P`[ T QH  pZdecode ,K \K;`pR@N4P X @㐰[  Xd X@[:_[?[@(TPdP X` X P` PZ@[XZ0putsrv  00|puttrm ,K \7K;_%Zputfil ,K \+K;@:PZ@0/.Z|putfil zchout write error, setting czseengetpkt ,K \K;8uD(Vx0/.t0/.xPhtD00%getpkt, entering with next t [<tPHWeT$xt7xtxP 0/<.Zgetpkt exact fitP$㼶 0000SF0! .0/.7 Zgetpkt leftover osizetP0/.Zgetpkt eof/eotgetch ,K \jJ;LP儰 ZpP 8 [ pPZ|P PT Z Zcanned 1,K \)J;l@SX[ZP0/-0/-PP0Z 0Zxcanned: cxseen czseentinit ,K \I;㤰Xp㈰〰xtd\İ@<PZ ,ZT,(plrinit 1,K \I;P@L #0 -p@t@@a0ZTransaction beginssinit ,K \I;LKl ^#0 -l0/-lPe\ $P?  *ZTransaction beginssinit: sndsrcToo many filesHP dL 4 xdPP fFile not found?  f*ZFile not foundP3@P ?  T*No readable file to send@ZNo readable file to send lPPZ lP /.a0 ,-0+/+,00#*,0p ',! @PpPpa = SWZstdin(Sending fromsinit: nfils filnam cmdstrlsipkt ,K \H;b!HN0 8I/Zrcvfil p,K \H;hD嘺l0 )0 2,`(P 8P 㘰XQta\KPd`U 0 ,0 )x*$ Receiving\ as0 h, ?  |)pZFailure to openCan't open filereof ,K \FH; PPDPDPP P 0/8,Z\ *** Discarding0/,, 0/&,D0/ ,`0/,Z end of file file characters communication line in communication line out reot ,K \G;L  !0 +P0/+L0/+0/+$0/+ZEnd of transaction files total file characters communication line in communication line out sfile 1,K \G;@dLT*8P LU ` P   ` 0 Q0llp'% $< P lnR Can't do system commandaE Unimplemented server functionl2PN 2 Can't change directoryUP P45 pCan't list directory<P 8 ԴCan't remove file? !Zq?  !ZP Pz lsCan't send helpP 㨵d< ȵ\Can't type filedP  pP  H P d5L -Can't check space$P ĶP| Can't do who commando Unimplemented generic server function(HTPZ Y pȚP   cPZ C Can't open file(B PZ + (8P xX P pe|ZP &PZ  Can't close file_lp,T [ :0 T P T\ PZ xpCan't open fileCan't execute command,,0 wP 0\' "P L stored as(D, wP T9DP5 .GPhP  !  PZ } Can't open fileԲ@  PZ h 4 r&@PZ P fPZ G Unknown packet typetblp@,0 4RpTT@HDHP`PXEXTS@pTħS Rpproto 0,K \>;LL84P (P?  $0ZllSorry, you must 'set speed' first D <.P\0$ n! ?  0Zproto ttopen localCan't open line p аP0X O!P @ @P ?  0Zproto ttopen localCan't condition line xPTTPP`@Entering server mode on P P  ? 0ZC-Kermit server done<Arthur cmd package (based on C-Kermit V1A(019)) 19 Dec 85Command? cmsetp ,K \L=;L0; @@U<,00S{>PZZ\cmsavp 3,K \+=;P@ D<U0Zprompt ,K \=;xP` oDZ %scmres㰰ᠬcmini ,K \<;04Ȱ P "" "R 0Zԭstripq[\[0S 000S[cmnum ,K \<;@PL R DpZcmnum: illegal radix - %d `0/4 VpZP ^pZcmnum: cmfld CpZ ?not a number - %s cmofi w,K \<;P@L[ `PpZ P CpZOutput file ?Wildcards not allowed - %s P CpZ ?Write permission denied - %s pZcmifi ,K \?<;@Ppp`V `i(>(H0p# P' %ncmifi: getwdZWd@PZ ((0/(P" P JCZ *wild ?No files match - %s XZ9CZ ?Too many files match - %s # p 'CZ ?Read permission denied - %s x CZ ?File not readable - %s XZ CZ ?File not found - %s WP B뀶%s )(P !p `*F X BZ ?No files match - %s X BZ ?Too many files match - %s Xj@`xG` BkPZ<%s 4P4BB WF圶 `*F X BZ %s Input file specification ?No files match - %s X $uBZ ?Too many file match - %s jB`V `V, one of the following: SB<(OBx` %s%schkwld[ 0*S 0@S 0Scmfld ,K \:;P`pI 夀X J 0(<0/7P3 1  cmfld: getwd xZY4 `PZY AZ%s  P AA 4* A %s Please complete this field %s%scmtxt ,K \_:;P`ppK0 / p T 帲 cmtxt, cmflgs, 帲  夀X  @K  0 2*0/P: 8 cmtxt: getwd xZ 4P`ZP\A%%s "PPANA  JA %s Text string %s%s?AZ ?Unexpected return code from getwd() - %d [cmkey ,K \9;`p]xLL 夐YD 0!/!@ 0!/!: 0/500 -P6cmkey: table length cmflgs zzcmkey: getwd ZP 0 p p Z @Z ?Ambiguous - %s @Z ?Invalid - %s PP  @n0 %s cmkey: default0 u0 ycmkey: escy @Z ?Invalid - %s  @ z@40/ Z%s cmkey: addbuf0 ?p ? [@\ %s %s%sy R@夰 Z ?Invalid ,P,#C@(A@ Y< 0RP dPYD !@" %s, one of the following: One of the following: ԭ%s%s  @Z %d - Unexpected return code from getwd &cmcfm ,K \8;hA0!/!PPPZ @ap夁 0P P cmcfm: cmflgscmcfm: getwd ZUZ?Z?Not confirmed - %s U ?Z ?Not confirmed - %s ? ? Type a carriage return to confirm the command %s%sclrhlp laddhlp ,K \8;p0HCX'` PP 0  7 P0P0`ZXPZ +K Zdmphlp ,K \7;<T00 0 .?Z %s lookup ,K \7;@P`5pP VZFX'PP  PPY  PP (ZYZFX FPPZF(FZgetwd ,K \s7;U@p(e0)/)2)/)2&/&0 "Ȱ P``V P`p VZtgetwd: cmdbuf bp pp cmdbufWY\Vp3 V ``b V10X (@P (00 0set vdu -mode 0(@P3Z V V3㬲X% (@P (0 (? V(@P ( 00( ?ZY?V(@P( 00(?㬲Z V㬲ZV V夸 P @ Pᬲ lᰲ[ࣤZyVI` `0@2PTZV6t P GZᬲK⬲i@ @@P P i@ @@P PZV `*x=! %s%sX (@P( 00(?W V ⬲ᬲp㬲 [ M=Z ?Buffer full addbuf@,,0T    0 R "R 㬲䬲㬲setatm@,  [  [ 00 [ [ [ [digitsP ( 00 00Sclower q,K \5;P`P @@ 1iP`PpZtest4Arthur Connect Command (based on C-Kermit V4C(010)) 19 Dec 85vdus 1,K \P5;PP0Z @FP0Z鸮bbc_wipe ,K \:5;@P`pTZUZTEEEEE EEZterm_cl ,K \5; EZterm_bs ,K \5;EZterm_cm s,K \4;@P@aEEEpZterm_nd ,K \4; EZterm_up ,K \4; EZterm_ce ,K \4;L  0O ~ Zterm_cd ,K \4;O@L  0 c P 0 X Zterm_ta ,K \4;b @L  ;EPp5E3PZterm_ho ,K \k4;p!EZterm_so 0,K \^4;PCEE E E0Zterm_se 0,K \G4;PDDDDD0Zemul_start ,K \/4;\t@P(LZGX IVDD DD`D`VDD DD`D`V @@ @ gU P P aUX  P WU尠   OUfZRAWKB:RAWVDU:putseq p,K \3;fPUpZ4@ PoD ;PUpZԮ[%x]answer ,K \3;c/cZccZVT52_inch q,K \3;V@`VF`00 0` P񏐭!]u V V pZ  pZ"D$Pu pZDJV" >V+ AV CV HV pZ (KV YV pZ [V pZ e pZR pZ pZ` pZZ pZ] pZ4V 7V cV mV  pZj pZD pZmV pZ6 pZ F pZ F pZV pZ  pZJV pZ pZ @ @pZlinebreak 0,K \2;P@(L P`  @ 8T 3T 1T /T P  @ &T0ZVT52_outch ,K \2;P@poU Z U ZUz PEUt U En bZ<>,.45O78J ]DCBAemul_finish ,K \p2;XP@(L#CC CgCp`CpW P S @ P S @ P S P S%eT?H=HZconect ,K⃾L [*2;Lp&909P5y9  Db`h@HP+ @P`V= P: /b3 You are now connected to your host computer Press F1 to return to local kermit (Session logged to %s)  @P@P X`V PaP T P0EPP @D  0  Y0EPPPUPÀE0PS  Hp Wp0EPP YP  P >8Z Return to Arthur-Kermit.  P  P  P    OaN C to close the connection, or: S for status ? for help B to send a BREAK 0 to send a null escape character twice to send the escape character. hconne ,K \)1;(~ n @K  ZCommand> chstr ,K \1; @ R8@ "}8Z'%c' CTRL-%cdoesc<0Arthur Dial Command (not yet implemented) 27 July 87No dial-out supporteddial ,K \0; :88868)48528@08Z The dial command has not been implemented. Acorn would be interested to hear from you if you have an auto-dial modem you wish to attach to the Archimedes. In particular we would like to know how many people want to use Acorn Prestel modems with their workstations. /Arthur file support, 25 June 87 Acorn Arthurcat delete type pwd dir run du run du users Buffer 1,K \g0;@PpcpppOl0Z BFlush 1,K \T0;@0PpTlP  lAlF0Z霯BWrite ,K \:0;`p@pVGp[Z \P 0lll l PG pPZ tAZzkselfzopeni ,K \ 0;P`lpl@0 1/!PZU0 yZTx zopeni fp invoking zxcmdUCZINPUT:#JC1 SPXbZ zopenizopenizopeno s,K \/;P`@PpZ UD pZVDU:UD pZOUTPUT:IvDU PHXbPpZzopeno can't openzclose q,K \q/;PaAPpZU PpZPPbEbpZzchin ,K \K/;`pR@lPZ"?PZ GAPZZzsout s,K \+/;@PNPpZ `oI <pZzsoutl 3,K \/;P@4P0Z 0Zzsoutx 7,K \.;@ S0Zzchout ,K \.;L0 0 4Zchkfn ,K \.; P 0/KZchkfn: file number out of range cpZzchki 1,K \.;P@L@H0 (>P0Z P0Zzchkozdelet ,K!L [.;L P 0SZ, 0 R   RP YZeditfname @, 0P P PQ0zrtol s,K \F.;=-P.@`00S0 0_ 0 /pZzltor ,K \%.;=/P.`-@p00S0 0 0 Zzchdir ,K!L [.;LP 0SZ 0 R   RP YZ&zhome hzxcmd q,KⅿL [-;P`HbLP 0SpZ{ > kerm-tmp } 0 R   RPB  Cb G FP G FP;kerm-tmpkerm-tmp XJA pZkerm-tmpzclosf ,K \-;I P Cb Zzxpand 1,K \m-;[0@2 dPNd? d0Z鬿zxpandznext 1,K \S-;@4\0d@dd[ Ed0 d0Zznextznewn x 00Ssplitpath ,K \-;P `P; AOh_p0 / W  Vq` splitpath mallocmalloc fails in splitpath()P.[ [PP.P P.PPPZfgen ,K \,;`p@^@dL.P.  @ EH0ĵu ἅ  Y _YZxtraverse ,KNL [,;@P`LTFgZPEF`F0  <P. ZV.PfP F0 ;pZ PZCpPZ X ..X DZP DF CP(DZaddresult ,K \%,;`P@ #uEP`@ PEZbFph} PEZDZ ./iswild0*P @P Pmatch0@, 0P^0@T ^ @^*^0 R P   0*Arthur-Kermit v1.3 (from C-Kermit 4C(052)) 12 Nov 87Kermit Server Commands: GET filespec REMOTE CWD [directory] REMOTE SPACE [dir] SEND filespec REMOTE DIR [filespec] REMOTE HOST command FINISH REMOTE DELETE filespec REMOTE WHO [user] REMOTE HELP REMOTE TYPE filespec BYE Arthur-C-Kermit server starting. Return to your local machine by typing its escape sequence; issue further commands from there; to shut down the Arthur-Kermit server, use command BYE or FINISH then re-CONNECT. main 3,K \1+;@P immediately i0ZDirtyFlush ,K \);1Ḵ(Zfx ,K \); K (Zinitrs 0,K \x);P@     0 vBPJ(40Ztermrs ,K \H);ܰC4J(Ztestbf s,K \5);`P@P P P XPpZ2XPpZ pZBad buff number putinbf ,K \ );3J(Znrsbuf ,K \(;5XZget_posn s,K \(;@PㆰxdaJ됴(pZmosbyte3r ,K \(;д KJZmosbyte3 ,K \(;Zgetcwd 0,K \(;P@P8L `JP 00Z%s (%d) 0  0P  $P$0Z SP0Z.  dA0Zdir ^pwd 0,K \t(;P0Z ,@@PMAS0Zdir du ,K \Z(;(L2@PZ B XP 0 /ZwADFS_Drives error %s (%d) 0< o XP 0 p/ZADFS_FreeSpace error %s (%d) 0 _/L2ZBytes free &%.8X = %ld Q'Arthur Script Command (not yet implemented) 1 July 87login ,K \';U/S/Q/Z The script command has not yet been implemented It needs a Arthur feature which is not available in versions 1.2 or before. 'Arthur tty I/O, July 23 1985Acorn Computers ArthurRS423:ttopen w,K \';@P``Bj; A<$ P$PpZpZttclos 0,K \';,P@ P = @$P0Z$=$@0Ztthangttresttpkt ,K \r';p3Zttvt ,K \f';pZ&Zttflui ,K \Z'; A 9 :PZesctrp ,K \I';TD7UZconint 1,K \:';@(*UQD$U@0Z*connoi ,K \$';@U@@Zttchk ,K \';  S:Zttxin s,K \ ';P`E PPpZlB 9EP[pZttol ,K \&; B$G8$=Zttoc ,K \&;B$7$=Zttinl ,K \&;@PLUTZ `` :pW| Z904  0(S Z Y ZpW`VU  ,,,,녰 PZttinc ,K \&;pLWl@` P 9P 9Z XW ,,,,뇰 PZttsndbmsleep ,K \Q&;Lb@ P \p,,,,^W*Zztime 1,K \-&;@  P|=P0Z$congm(concb ,K \&;F,p 9,0p:0ZRAWKB:VDU:conbin ,K \%;F,p 9,0p:0ZRAWKB:VDU:conres(conoc ,K \%;8G060o<Zconxo ,K \%; xG070_<Zconol ,K \%;@?Zconola 1,K \%;@PPP0Zconoll ,K \%; Zconchk ,K \%;lD[,8 DZconinc ,K \q%;LX`P p@PZ YX p,,,,t눰 PZconin ,K \A%;p ,7Z}$123fullhalfdisplaynamestypewarningend-of-packetpacket-lengthpad-characterpaddingstart-of-packettimeoutnonexon/xoffbellcresclfnonexoffxonconvertedliteralbinarytextevenmarknoneoddspaceoffondoprm q,K \$;P@ LEP񏐚~b|2 ~!,,pZ...Use 'set send' or 'set receive' instead. Type 'help set send' or 'help set receive' for more info. d;[pZ@<  PNMpZDevice namelSorry, can't open line 8=8P P0`!pZset line ?/H`PpZ[pZ`pZ1D8pZ<0  }`0/ DApZ5Number of seconds before starting to sendXYDELA: y?/HS`PpZPpZ`pZfullh 0 B 05pZDecimal ASCII code for escape character?/XlT"`PpZV VB V, pZ V \File parameterDd`PpZPpZh?/t[pZ#PpZ0pZconvertedhow to handle filenamest\?/h[pZPpZ$pZtexttype of file`*pZ?unexpected file parameter ?/L`PpZPpZ`pZxon/xoff?/,``PpZ[pZWV `pZnone?/iPpZ[pZtpZdirecttype of modem, direct means none(?/(XB`PpZr[pZ$`pZnone PpZ pZArthur-Kermit>Program's command prompt U|h;pe; #?d (`PpZV V VE Vl Parameter for outbound packetsParameter for inbound packetsV V 0  `PpZ U40Decimal ASCII code for packet terminatorpZ0  ~`PpZ U490Maximum number of characters in a packethpZd0  ~`PpZ U81Decimal ASCII code for packet-start characterpZ0 _ )`PpZ U80How many padding characters for inbound packetsxpZ|0 5 (`PpZ U80Decimal ASCII code for inbound pad characterpZ0  `PpZ U8,5Interpacket timeout intervaltlpZpl P ))pZ Speed setting can only be done on an external line You must 'set line' before issuing this command TtP (0 `PpZ`PpZ9`P(lBaud rate for %s?Unsupported line speed - %d  X  (pZ%s: %d baud [pZ (pZ頬Not working yet - %s chkspdKP ʖPPnPKPP K PP[P PK Pseton 1,K \!;@ ? /08PP0ZhP0ZP0Zonsetnum w,K \ ;P`@0/vTpZ^V B(pZG@P`pZsetnum ?Sorry, 94 is the maximum setcc 7,K \ ;@PR0ZUU (0Z ?Not in ASCII control range - %d  PP0Zdormt ,K \ ;8@8LPZP P P P P  P P. PG PZ u4 ))!PZ04 (  4P xp.8`X !2 +Ps 0 xRemote directory nameXZCWD: PXtake file ends prematurely in 'remote cwd' pswd from take file'P p`8 Password: t?P' *? Password of remote directory Password: P(@P(00 0($) P PIPP P P(@P $(0 D( ( 0 h ? 4C Z password4  ePZE4ZName of remote file(s) to delete4  NPZ?/4Dp ZRemote directory or file specificationPZ?/HX Z #Pcĥ88ZCommand for remote system4  PZS4kZRemote file(s) to print on remote printer4  PZ?/4U ZConfirm, or remote directory name4  PZT47ZRemote file specification4  PZ?/4W ZRemote user name, or carriage returnxPZk&Znot working yet - %s rfilop 3,K \;@PP T& 0Z 0 {?/ 0Z?File specification required rfilopscreen ,K \;`p8P8@PL9$P P ZDLh4@ P' /:A  ZKP KPZ=>   % Z, Size: %ldZY Y Y, Y@ Nḱ⸱K[ .Z [OK] ḱK[ .Z [discarded]KP .Z [interrupted] p.ZSkipping Z*** screen() called with bad status ***0  ~% O S8븱 Z%s: %ldYYZ DYwPZP ,0Y.0.01KPD ZZ9?5Z/-ZKP"˸Z븁ZKP Z0  % Z%s: %ldZ*** screen() called with bad object ***intmsg ,K \|;PL,50S 850S Z[% ?  ?  CTRL-F to cancel file, CTRL-R to resend current packetCTRL-B to cancel batch, CTRL-A for status report...?  gZ chkint ,K \9; P 8P Zlp0/WTPT@T`PpGPZPy P Pf conchkx|Px PZ ?  $?  DP ?  ^A Status report: file type: `binary?  ? ? ? ?p ?p Etext file number characters block check compression 8th-bit prefixing?  $^B - Cancelling Batch ?  ^F - Cancelling File ?  hZ^R - Resending ?  W[Z [Ignored] debug ?,K \o;@P@8^0Z P\'02;E<,0  #0Z%s%s%c   #0Z=%d  # 0Z[%s]  #0Z[%s]=%d 0Z  #0Z%s=%d 0  #0Z%s[%s] ,0  #0Z%s[%s]=%d   z#0Z ?Invalid format for debug() - %d tlog ,K \;`p@P@8[Z P{/@CN^H, 0 G#Z%s %ld %s ;#Z %ld  6 [ +#Z[%s] 5 [ 0 #oZ[%s] %ld Z 0  #_Z%s: %ld 5 [0 "MZ%s %s 5 [ ,0 "9Z%s %s: %ld ".Z ?Invalid format for tlog() - %ld Arthur User Interface (based on C-Kermit 4C(046)) 19 Dec 85cmdlin ,K \=;.-ⴰ就崱@┰P/ڄ`pP@0 -PP( xargv(@P@1u/uPhgP xrP cP P aP sP rP vPTvP TP P 2PK<sP LvP \rP lxP PP찟PP dPP\PiZactionl-l and -b required-a without -s, -r, or -gPunredirected -k can only be used in local modeLhtdoarg ,K \Y;RB̲P2 a@P)#$6B#=P#x conflicting actionsP ? / Fconflicting actionsPvconflicting actionsP㼱vconflicting actionsP"P#d┰@P,ڐtd-P 3P conflicting actionsinvalid argument bundling after -s-@PDP@`P"Y%›YP#P0P"0'/s崱imissing filename for -s-s: too many -'sinvalid mixture of filenames and '-' in -ssending from terminal not allowedPWP SK[ -PAr%conflicting actionsinvalid argument bundling after -gmissing filename for -gh就  4ZP嬷@P-Pinvalid argument bundling after -amissing name in -aP#@T@Ph-P|`n1t2P`invalid argument bundling after -lcommunication line device name missingPDX@Pl -P :jpҏHyinvalid argument bundlingmissing baudunsupported baud ratec`^d㤷Y Vdebug-logPbdx@P -PP nP eP mP invalid argument bundlingmissing parityoP sP *invalid parity(  PZinvalid argument, type 'kermit -h' for helpfatal ,K \;@ 4PG0 &Z Fatal: %s tFatal:ermsg ,K \;@ P0$ TP%0 Z\ %s - %s Error -!byeccloseconnectcwddialdirectoryechoexitfinishgethelplogquitrreceiveremotesscriptsendserversetshowspacestatisticstakebaudblock-checkdelayduplexend-of-packetescape-characterfileflow-controlhandshakelinemodem-dialerpacket-lengthpad-characterpaddingparitypromptreceivesendspeedstart-of-packettimeoutcwddeletedirectoryhelphostspacetypewhodebuggingpacketssessiontransactionsparametersversionscmdini p,K \B;$oDQDAP$,t0 ,JOIPذP //P9/ 7/7!P 0 .P8 P5(/(!P' 0 z$XRAWVDU:X%s for %s Type ? for help Arthur-Kermit>/kermrc-cmdrinit filekermrc-cmdrinit file0/TpZno init filetrap ,K \;@0/?Zterminal interrupt...parser ,K \;0P $\P\q @ ` l @pڼ @Xp.(p`t弱 !!Pt꠬ ذ@`FV V0ذذPW\P pGCommand too long for internal bufferm*$G8帱0|0PD XaXq̂`@+?/tXc0/ p p( p p #LCommandtop-level cmkey@Pp %9 @PtP\ lP ZKermit command error in background executionKermit command error: take file terminated.ldoexit 1,K \;PxAx+1DP  N. l<P ,P P 0D/D7-P ܰ!P İ㴰P 0'/'㤰(L  6("0ZHh<Debug Log Closedp@DTransaction Log Closed  Kermit done. bldlen s,K \K;P`/@ -pZsetgen ,K \5;P`t@0 0000S [ [ @0 gpZsetgendocmd ,K \;G* tP) Z Z*[ZpP ZYou have to 'set line' first ?/Ln⸷Z[ZfvZ $PZ &P B=X ZName of local directory, or carriage return%s ? /X8p ZWhich log to close?You must tell which log PZ[ZP P P2 PH `P Z?Debugging log wasn't open ,Z P tZ?Packet log wasn't open \lZxP \Z?Session log wasn't open wZ P DZ?Transaction log wasn't open \^Z-Z ?Unexpected log designator - %ld  \[Z ZNumber to be dialed G[Z,M @ 0@ >Z@Directory/file specification4%s %s  "PZ  ZMaterial to be echoed%s {ZPZ P ZYou have to 'set line' first ?/F( ZT P Z You have to 'set line' first x'  { pZName of remote file(s), or carriage returnPp8|!d[P O$@@帿P! LP MPXTLtake file ends prematurely in 'get'take file ends prematurely in 'get'(L( %00p4Y0@` Z0 Cp 0P ]0Z Remote file specification: Name of remote file(s) cmtxt P  @Z(cancelled) Z@A+@#20]0P,q0P `@ 0p0Z 0pZ Local name to store it under: Local file name(cancelled) P 0 PPZ(r tPZ? /8^) ZhelpArthur-Kermit command ? /XKprZWhat to log?You must specify what is to be logged PZZ  [Z ZText of login script  Tp pZName under which to store the file, or CR0\ J#[Zv(PZcmofi cmarg2lLP Z You have to 'set line' first ? /@$Dp ZRemote Kermit server commandX?You must specify a command for the remote server Z⼵夾0 [pZZFile(s) to send?A file specification is required t h)0/P&  PZSend: wildName to send it with}[Z$l0 HP 0` sPȲZSending: as:Q[ZxL P,Z ? /00p+ZParameterX?You must specify a parameter to set PZZ  JPZ ;ZArthur command to execute?/d[ZPZP P Dparameters[? ! |,t0 hl0h dh d꬧X %s %s %s %s %s %s for %s 0,%s for %s %s %s %s Z Nothing to show... [Z _;ZHPZ(x-t.p3l8h=dCb PF] E[EY(PHT HRZ Most recent transaction --  files: %ld 4 total file characters : %ld ( communication line in : %ld , communication line out : %ld  block check type used : %d compression : no yes 8th bit prefixing : no yes P Z?Take files nested too deeply 0 Q[pZ ZArthur-Kermit command file?A file specification is required P Z?Wildcards not allowed in command file name  'PZX0弱⼱ PZ 80 @ZrXtakeCan't open command file - %s Failure to open Z頬Not available - %s shopar ,K \;d `rT Pm k hRX0XX傰  ^ Line: %s, speed: %d, mode: remotelocal( R$R0傰  =;@mP P# eP %, modem-dialer: %s Parity: oP sP !evenoddmark spacenoneTP LPinvalid - %d, duplex: full, half, flow: xon/xoffPnone<  0P $ %d, handshake: %d  ~ 0 ,H0D @d0` \P P P| zxPs qnljPe b`P[ XVPQ NLPG DBZnone  Delay: %d lp Send timeout: %d, receive timeout: %d x Send padding: %d, pad character: %d | Receive padding: %d pad character: %d d Send Packet start: %d, end: %d, length: %d h Receive Packet start: %d, end: %d, length: %d Block check: %d File parameters: Names: \literal converted Type: `text binary Warning: doff on Display: hon off kermrc-cmd Init File: %s Logs: Debugging: <nonep%s Packets: @none%s Session: Dnone%s Transactions: Hnone %s dolog q,K \2 ;P8@LU U U! U/ ? `Gdebug-logName of debugging log file `7packet-logName of packet log file y`(sess-logName of session log file i`trans-logName of transaction log file@pZ ?Unexpected log designator - %d VpZ H`]% `2`PpZU U U! UpZ2 a pZ= `P 6%㰲`pZ( `P !%ܲ`pZ [  %0h 0/p| <0 / tTransaction Log:pZdebopn 1,K \T ;@(TLPP$0H 0/@ 0 / XDebug Log P0Za Usage: kermit [-x arg [-x arg]...[-yyy]..]] x is an option that requires an argument, y an option with no argument: actions (* options also require -l and -b) -- -s file(s) send (use '-s -' to send from stdin) -r receive -k receive to stdout * -g file(s) get remote file(s) from server (quote wildcards) -a name alternate name, used with -s, -r, -g -x enter server mode * -f finish remote server * -c connect before transaction * -n connect after transaction -h help - print this message settings -- -l line communication line device -b baud line speed, e.g. 1200 -i binary file or Unix-to-Unix -p x parity, x is one of e,o,m,s,n -t line turnaround handshake = xon, half duplex -w don't write over preexisting files -q be quiet during file transfer -d log debugging info to debug.log If no action command is included, enter interactive dialog. usage ,K \ ;DZ  Type ? for a list of commands, type 'help x' for any command x. While typing commands, use the following special characters: DEL, RUBOUT, BACKSPACE, CTRL-H: Delete the most recent character typed. CTRL-W: Delete the most recent word typed. CTRL-U: Delete the current line. CTRL-R: Redisplay the current line. ? (question mark) display help on the current command or field. TAB (tab key '->|') Attempt to complete the current field. ESC (escape key) Quit the kermit program. Connection may not be severed. \ (backslash) include the following character literally. From system level, type 'kermit -h' to get help about command line args. Shut down and log out a remote Kermit serverClose one of the following logs: session, transaction, packet, debugging -- 'help log' for further info.Connect to a remote system via the tty device given in the most recent 'set line' commandFormat: 'get filespec'. Tell the remote Kermit server to send the named files. If filespec is omitted, then you are prompted for the remote and local filenames separately.Record information in a log file: debugging Debugging information, to help track down (default debug-log) bugs in the Arthur-Kermit program. packets Kermit packets, to help track down protocol problems. (packet-log) session Terminal session, during CONNECT command. (session-log) transactions Names and statistics about files transferred. (transact-log) Syntax: script text Login to a remote system using the text provided. The login script is intended to operate similarly to uucp "L.sys" entries. A login script is a sequence of the form: expect send [expect send] . . . where 'expect' is a prompt or message to be issued by the remote site, and 'send' is the names, numbers, etc, to return. The send may also be the keyword EOT, to send control-d, or BREAK, to send a break. Letters in send may be prefixed by ~ to send special characters. These are: ~b backspace, ~s space, ~q '?', ~n linefeed, ~r return, ~c don't append a return, and ~o[o[o]] for octal of a character. As with some uucp systems, sent strings are followed by ~r unless they end with ~c. Only the last 7 characters in each expect are matched. A null expect, e.g. ~0 or two adjacent dashes, causes a short delay. If you expect that a sequence might not arrive, as with uucp, conditional sequences may be expressed in the form: -send-expect[-send-expect[...]] where dashed sequences are followed as long as previous expects fail. Format: 'receive [filespec]'. Wait for a file to arrive from the other Kermit, which must be given a 'send' command. If the optional filespec is given, the (first) incoming file will be stored under that name, otherwise it will be stored under the name it arrives with.Format: 'send file1 [file2]'. File1 may contain wildcard characters '*' or '?'. If no wildcards, then file2 may be used to specify the name file1 is sent under; if file2 is omitted, file1 is sent under its own name.Enter server mode on the currently selected line. All further commands will be taken in packet form from the other Kermit program.The 'set' command is used to establish various communication or file parameters. The 'show' command can be used to display the values of 'set' parameters. Help is available for each individual parameter; type 'help set ?' to see what's available. Type of packet block check to be used for error detection, 1, 2, or 3. Type 1 is standard, and catches most errors. Types 2 and 3 specify more rigorous checking at the cost of higher overhead. Not all Kermit programs support types 2 and 3. set file: names, type, warning, display. 'names' are normally 'converted', which means file names are converted to 'common form' during transmission; 'literal' means use filenames literally (useful between like systems). 'type' is normally 'text', in which conversion is done between Unix newlines and CRLF line delimiters; 'binary' means to do no conversion. Use 'binary' for executable programs or binary data. 'warning' is 'on' or 'off', normally off. When off, incoming files will overwrite existing files of the same name. When on, new names will be given to incoming files whose names are the same as existing files. 'display' is normally 'on', causing file transfer progress to be displayed on your screen when in local mode. 'set display off' is useful for allowing file transfers to proceed in the background. The 'remote' command is used to send file management instructions to a remote Kermit server. There should already be a Kermit running in server mode on the other end of the currently selected line. Type 'remote ?' to see a list of available remote commands. Type 'help remote x' to get further information about a particular remote command 'x'. dohlp ,K \;PZ)Pa(_+.\0Z@WWavQPNMLKJIiE=;:9*tFZ  xAZ|=Z:ZChange Working Directory, equivalent to Unix 'cd' command(ZDelete a local file or filesZDial a number using modem autodialerZDisplay a directory of local filesZDisplay the rest of the command on the terminal, useful in command files.ZExit from the Kermit program, closing any open logs.ZTell the remote Kermit server to shut down without logging out.ZZpZZZ?/PLf@pZ tZ PZZRemote commandXZZ?/LHD@pZ tZ qPZZParameterTX{ZDisplay current values of 'set' parameters; 'show version' will display program version information for each of the Arthur-Kermit modules.UZDisplay disk usage in current device, directoryFZDisplay statistics about most recent file transfer6ZTake Kermit commands from the named file. Kermit command files may themselves contain 'take' commands, up to a reasonable depth of nesting.PZ  Z頬Not available yet - %s hmsg ,K \~;@PZZhmsga ,K \n;Pp@PZ`t(`P( ` Zdohset ,K \P;X@pT Z PZP @ P񏐤+-Ca{}PT P P Z P Prompt string for this program, normally 'Arthur-Kermit>'.P+ P wZnZNumber of seconds to wait before sending first packet after 'send' command.WUZDuring 'connect': 'full' means remote host echoes, 'half' means this programdoes its own echoing.4 ZDecimal ASCII value for escape character during 'connect', normally 28 (Control-\) %sIZ$ZType of flow control to be used. Choices are 'xon/xoff' and 'none'.normally xon/xoff.ZDecimal ASCII value for character to use for half duplex line turnaroundhandshake. Normally, handshaking is not done. P ) 9IZduZDevice name of communication line to use. Normally %s. If you set the line to other than %s, then Kermit will be in 'local' mode; 'set line' will reset Kermit to remote mode. If the line has a modem, and if the modem-dialer is set to direct, thiscommand causes waiting for a carrier detect (e.g. on a hayes type modem).This can be used to wait for incoming calls.To use the modem to dial out, first set modem-dialer (e.g., to hayes), thenset line, next issue the dial command, and finally connect.<:*8;6ZType of modem for dialing remote connections. Needed to indicate modem canbe commanded to dial without 'carrier detect' from modem. Many recentlymanufactured modems use 'hayes' protocol. Type 'set modem ?' to see whattypes of modems are supported by this program.ZParity to use during terminal connection and file transfer:even, odd, mark, space, or none. Normally none.!ZCommunication line speed for external tty line specified in most recent'set line' command. Any of the common baud rates: 0, 75, 150, 300, 1200, 2400, 4800, 9600, 19200. ,;ZSpecify parameters for inbound packets:End-Of-Packet (ASCII value), Packet-Length (94 or less),Padding (amount, 94 or less), Pad-Character (ASCII value),Start-Of-Packet (ASCII value), and Timeout (94 seconds or less),all specified as decimal numbers. IG E-C<AZSpecify parameters for outbound packets:End-Of-Packet (ASCII value), Packet-Length (94 or less),Padding (amount, 94 or less), Pad-Character (ASCII value),Start-Of-Packet (ASCII value), and Timeout (94 seconds or less),all specified as decimal numbers.ZNot available yet - %s dohrmt ,K \;pd Z PZP Z jP( Z P3 Z P= Z PL Z e\Send a command to the remote system in its own command language through the remote Kermit server.Ask remote Kermit server to change its working directory.Ask remote Kermit server to delete the named file(s).Ask remote Kermit server to provide directory listing of the named file(s).Ask remote Kermit server to tell you what services it provides.P Z P Z P+ Z lPZ(>_ZAsk the remote Kermit server to tell you about its disk space.Ask the remote Kermit server to type the named file(s) on your screen.Ask the remote Kermit server to list who's logged in, or to give information about the specified user.not working yet - %s  0|@0||xxx 00J`P\ Q)C܂0,+(Х0 ddPU.  PC `BaB+ PP11 1:0QA 0 [`BP+) `B+QaB PP11 1:0QA 0 [`BP  PP11 1:0QA 0  . P#P1  PP1 PP1 PP1 PP1  P P1@, 0 l,@, 0 f,@, 0 `,M@,-W  #c c@,@ #c0@,P #c0#cc c0@, @Pc0p@,`<<cp cc ᄥ 0/ ,,쀁,쀁, 쀁p0  PZ h L8 刁刁,ڀP,ڀ`,@, 쀁0 ,쀁, 쀁0 , 쀁0 , `0 ^fp_round @, ^ 5^ 5^00^ ^ 00r9^000000S 0S  0CSfp_digits ,K \;@,, L ,,6 2<0S [# 0; 0 R16  *    6   00c0 K00 R  ,K00 R  LA0 0  R0 0Zfp_addexp ,K \;p Pd`O0Yi-0+0Y 00 0 dY 00 0  00 0 00 Zvfprintf ,K \*;@LP`%P K[ 0 'PI0L`,0,0 0 [ #[ +[ -[ ````00*S (000C[k`&, 0, 00000S`0 c0 0 B , , 0 0  [ p0.[" ,0,0 0*[ (000C ,0,0 0 000K ,, 00 R`0l[ 0L[ `,0,0 00h[@`,0,0 00g[p c[! [u E[h G[f X[ d[D e[_ f[] p[ i[: n[e o[ s[h u[" x[ (K0pG 0pGWP@P0_pGW@P0 0 0JP  0`pGWP@P0`/pGW0N,@, 0I(0P0AL(0N X pG 0pGWP@P0pGW X@P 00 X P  0`pGWP@P0`pGW4(K@z0123456789ABCDEF0X(0@b0123456789abcdef0x(0  `M0123456789abcdef@(0;@60(0;@&(00;@8C8Sc-0 + l(000C 0g[O d[> E[ G[G X[ e[ f[G p[ i[, o[ u[' x[ [   0  +[P 00 0PP  0 0  kPL,  - +6Pg`[00  0.0 0 H HYI  ^P @P.+P [ 00K[0. [ 0 0K[0.<@ Pu> 0 nYOP I[ P0  P.00@ PD >0 0=0IS 0I S<0I0 @. 0 X! >0 0 P 0S0S.00XIL,  - +=XX Pp .6 f4P P0  P.00` 0S 0CS0S00 S.  .P II0P I .PI XH >0 04fP 40@ CL,7  - +XH  X . P> 0 40 `  P @P@ HX  pG20L 0pGWP@P 00 pGW0K[ 00PPL 0pGWP@P 0 pGW X X<P >P 9 @ PEP@P0 0 0f @ P-@P(P@P0 0 0I@P0K[00 03P X4HXP@P0 0 0HX PI PK[ 0  I P  0`pGWPK[0`pGW0,, PZfprintf ,,K \;L y0 0Zprintf ,,K \;L (a0 0Ztsprintf ,0,K \;@,L (    :P@P0@n 0Zvprintf ,K \K; (Zvsprintf ,K \<;P`p@(L(  i P   P @P 0@ +ZSfgetc ,K \ ;00C0SZ00Zfputc ,K \;0K[Z00 0Zgetc ,K \;00C0SZ00Zgetchar ,K \;40K[oZ00Ztputc ,K \;0K[Z00 0Zputchar ,K \;(0  B R(Z( 00Zfeof @ferror clearerr  setvbuf@,0 @   R  R  R$@NT["[#!( setbuf ,K \D;:Q Zungetcp 0 S00K_writebuf ,K \;P`p@L  X L X c!,0 0  B00PZ Z_flushbuf ,K \;P`@ p uP  Z_  P f pz p P${ p B) {  pP  PZ@Z0 0K;0 S 0 SZ00 [PZfflush ,K \s;`P@ PZ   pP  @;PZpP  Z_fillbuf ,K \K;P@ p 6P    @  Zz p  ( { pK0` V Rp pV  ,0 P 0  P  @ @ZKZ_fillb2 ,K \;@pZ KZfclose ,K \;P@`p Z AV ( ㅵ{L   ( Z$.tmp.x%.8xfreopen ,K \;P`p@aP rP wPZ+P bP  pZ   Zfopen ,K \W;0)   Z 0SZ_fopen_string_file ,K \>;P`9 @q f @PP`ZPZ_fisatty  P_initio ,K \;P`pᬊ@L ->P (jP # s  \P  e y( NP  W kZwCouldn't write %srCouldn't read %swCouldn't write %s_terminateio 0,K \;[@@T@@T0Zfgets ,K \;P`@p  P0F`PK[08{{WZ @Zfputs s,K \v;P`@0K[00 0yppZ PpZ_read ,K \S;P`p@P  O K Z A PH0@IpFZfread ,K \!;P`VpZ  @ pZ_write ,K \;P`p@T@P 00{Z XZfwrite ,K \;`PUpZ  @N pZgets ,K \;`@p_@P0^p PpWZ @Zputs ,K \;`p @Pt(0@P( 00 ( pZ [(K[(Z(00@Zftell0Kfseek ,K \[;P`@p 00Z [Z R R RZK` }P Z00 C[ `   @@`pZrewind ,K \;@ Zfgetpos ,K \ ;@Zfsetpos ,K \;@ Ztmpnam 1,K \;P<2@UP T0Zt$.tmp.x%.8xtmpfile ,K \;L@0☲@ $@ 7 aP 0480 @ Z$.tmp.x%.8xw+brandH0僰 k k9  srand_exit_init 8atexitT0!P   0exit q,K \l;`PP @@@PepZabort ,K \P;@ ZabsP`labsP`div w,K \6;P@`L   pZldiv w,K \;P@`L   pZbsearch ,,K \;@P`VZV PZp_ PZ P`PF`@partition_sort ,KNL [;@LP〰 U LPEa/pK( P 00`pK[00K[`FpG( P4( P 00`K[00K[`FH 00p@P00@PpGHH 00p@P00@PHpp ( PH ( PX 00pK[00K[pGH 00pK[00K[pGG@KK P [ ڄ0a0 P1`+ P' P ڄ0q 0 P 1 [`U Zqsort ,K \;@P`UZ X0 pH-WZpIY P 0S!* @ R B R0S:[ * 0@ S0C S [:WZGetFileInformation ,K \m;`p@@P@@@p<P 0 PZt%s (%d) PZ #P 0 PZ%s (%d) pP 0 PuZ%s (%d)   ZEndOfFile ,K \;0d@`僰 P 4POP @ZENDOFFILE, op on unused stream (%d) ENDOFFILE, op on unused streamEnd of file unimplemented functionSWriteByte ,K \;@0 倰 !ര [ o  2ji2AP[Z pPnSWRITEBYTE, op on unused stream (%d) 8pZ [ S  T$>L IcE PZ5 PZ% 0 $USWB unimplemented functionPZSWRITEBYTE WOW should never get here!! ZXSWriteByte ,K \@;B0 #倰 # [ w  132;JYcb PixXSWRITEBYTE, op on unused stream (%d) pZ e S H F^8>HV ;S8PMXSWB unimplemented function PZ6 PZ&`0 H$XSW unimplemented function|PaZXSWRITEBYTE WOW should never get here!! ZXSBlockWrite ,K \;pe5倰 5 [ 񏐇 ":@P`rq TPXSBLOCKWRITE, op on unused stream (%d) 0  PZrXoD P ` Pd> XYXVXP0 PZ?0 PZ.X EPP $XDXSBLKW unimplemented functionD PKZXSBLOCK WRITE WOW should never get here!! ZSReadByte 1,K \;0 HHLP(僰 [ l ih!*3@MXW PkSREADBYTE, op on unused stream (%d)  { 0ZQSRB unimplemented function P@qP 0Z  0Z  0Z [0Z 0ZoSRB unimplemented functionP0ZSREADBYTE WOW should never get here!! 0ZXSReadByte 1,K \[;[JL:倰 [ i fe!*3>JUT PyXSREADBYTE, op on unused stream (%d) # { 0Z_XSRB unimplemented function P@P 0Z0  0Z0  0Z  [0Z 0Z&XSRB unimplemented function P( P# P0ZXSREADBYTE WOW should never get here!! Type is %lx Type is %lx 0ZXBytesOutstanding q,K \; m =傰 [ N KJ)(+*3:9PPXBYTESOUTSTANDING, op on unused stream (%d) &@ )P  EpZpZk)BO unimplemented functionP pZYBO unimplemented functionPpZBYTES OUTSTANDING WOW should never get here!! pZdummyXFindInput ,K \?;`_OyppZ ?凰 dP  VDU:XFI VDU unimplemented functionRP  RAWVDU:XFI RVDU unimplemented function@P0凰 000凰 0P KB:t&P0$凰 080凰 0DP TRAWKB:  P 0凰 凰 BBC: P ㇰ 凰 TTY:/P-ㇰ P ^& $ $ $ $kjRS423:P r`PRINTER:XFI PR unimplemented functionP _MINPUT:XFI IP unimplemented functionP M;OUTPUTXFI OP unimplemented functionP ;)CONTROL:XFI CTL unimplemented functionoP (ERROR:XFI ERR unimplemented function PZ 0ㇰ 0凰 ZrXFindOutput ,K \;`SCLppZ 0凰 07P 0凰 0(0⇰ 0VDU:%P (4凰 <(⇰ RAWVDU:P KB:XFO KB unimplemented functionP RAWKB:XFO RKB unimplemented functionP 0凰 0(0⇰ 0BBC: P ㇰ T(⇰ TTY:/P.ㇰ P P $ $ $ $L@kRS423:P R`PRINTER:XFO PR unimplemented functionP ?MINPUT:XFO IP unimplemented functiontP -;OUTPUTXFO OP unimplemented functionbP )CONTROL:XFO CTL unimplemented functionOP ERROR:XFO ERR unimplemented function PZ 0ㇰ 0凰 ZwXCloseStream 1,K \;H X 8倰 [ ` ~! *JI PrXCLOSESTREAM, op on unused stream (%d) P0ZaP @YVXC TTY unimplemented functionPR( $! $ $@-*XC NULLDEV unimplemented function P P P0ZCLOSESTREAM OUTPUT WOW should never get here!! Type is %lx Type is %lx 0ZXSFlushOutput 1,K \U;ZJ:倰 [ M kj 76 P^XSFLUSHOUTPUT, op on unused stream (%d) P0Z0ZP0Z DPE=P= 5XSF RS423 unimplemented function)XSV NULLDEV unimplemented function P? P: P60ZXSFLUSH OUTPUT WOW should never get here!! Type is %lx Type is %lx 0ZExpand ,,K \;ZExpand - not yet implemented!! getnextstr <倰 [PisattyXStandardTime 3,K \;P@@E P@0Z 0 | P0Z%s (%d) XBinaryTime ,K \;M & $PZ $0$ PZ%s (%d) opendir q,K \h;P@`PpZ BPpZ @pZreaddir q,K \L;P`@ B   PpZ PppZ*Bo@q pZtelldirseekdirclosedir ,K \;@fdZ;memcpy@, 000"! 0B [B ^0 B ^B [memmove@, 000 "! P 0B [B ^1B ^3!B ^ P 0B [B ^ 0B ^saB [_memcpy@,"!B0 S00B0 Sstrcpy0@, 3@@ PD [0DD[0strncpyp@,3P BR:P `E@@@@ 0B [p@[ 0B [p@0B [p0B [pstrcat0[ 0[[strncat@,0[ 0[B [[B [memcmp0 0 BR:Q B P QAB Pstrcmp@, ,($3[K   0RBR strncmp0@,00C BR:P0U0EP00 0B ^ 0SC0S 0B0 S 0memchrB0 S 0S B0 Sstrchr0 S0S strrchr0[s [Sstrspn@, 0SB^B^ strcspn@,0SK ^ ^K^strpbrk@,^0 R R  Rstrstr@, 0S0S  0S strtok ,K \;`,P@V``Pp<p`P@`Zmemset@,0RR :  BR* BRstrlen@,  [@3 @N   @ch_val0  0@ c   a@ 00 A@ P rd_signed_int ,,K \e;@PL`p 0K[00 0 +Y -Y K[0pW/0Y- * p@P0WxY XYpK[0Lk `pK[0W RPW  ELY UY! lY uY 9p@P0cWuY UYp# mp@P00FWlY LYp P LP`f Z0  @@ ``Zrd_int ,,K \_;@P`Lp帴0@P 00  0YAK[0V.P+xY XY'@P0 p@P0X lP Z0 KppZcarefully_narrow,,,K~[  [D@rd_real ,,K \;P`Lp   GK[0-+P -P @P0p @WC.PY@P00pW+ & 0# 0#0@ YHYK[0pWJeP EPF@pK[0+P -P &W#p@P00@@@P00pW YH P  P Pk P  P   H 0# 2+ H {=X[ P -dX h P@   @P  @P P   Z0 ,,l Z0Zrd_string ,,K \&;@P`}K[0p0HZ0;~K[0`FVp  pHZvfscanf ,K \;`Lp XH %XH ( $pG< @ P@P0L[ @ @P00P  ;ZL*Pp 0 @ c RZ 0K[Z lXLXhXfX [XA %X! EX GX XX1 cX dX eX pX  gX iX nX oX sX uX xX Z@P0%P@Z(L ^P p 0PX0Z @ Q@ b]X P 0 P (0$$$(@(P",,K[00Wx @ ;Q@ x ,@,T$00,(@0@PPK[0pZ @P,0 (K,0 (B,0 (9(00i,0 (%,0 (,0 (, 0 (,0 (p PZ P /*(fscanf ,,K \;L 0 0Zscanf ,,K \;L 0 0Ztsscanf ,,K \;,L((     (  0(0Zstrtod 3,K \;@P L 0 p PU@0Z%lf%nU 0Zstrtol ,K \d;@LP,P,P@pW +W -W p0WpxW XWT T@pT@T @p`WP`@VpWY a(PVa`fXE,Zstrtoul ,K \;@LP,P,P Y 0YxY XYT T@T@T @ O`pYG pC'htxV#%9YP \1XE,0Zatof 1,K \;Q@@0Zatoi 1,K \;Q@ +@0Zatol 1,K \;R@ @0Zosbyte ,K \{;Zosbyte1 ,K \o;(L  A    Zosword ,K \U;(L  Zosgbpb ,K \D; Zosfile ,K \8;Zosargs ,K \,; }Zosfind ,K \ ; qZadval ,K \;Zclg ,K \ ;CZcls ,K \; 9Zcolour ,K \;@-+Zcircle w,K \;`P@ pZcirclefill w,K \;`P@ pZcursor ,K \;,0 ,0 Zdraw 3,K \;@P    0Zdrawby 3,K \;@P    0Zfill ,K \; Zgcol 3,K \t;P@   0Zgwindow ,K \c;Pp`@     Zinkey ,K \L; [ZZmode ,K \<;@u s Zmove 3,K \.;@Pf d ` ^ 0Zmoveby 3,K \;@PS Q M K 0Zorigin 3,K \;P@@ < : 0Zpalette ,,K \;pP`@+ ) ' % # ! Zplot w,K \;P`@    pZpoint ,K \;L@ @K K K  X @Zpos ,K \;/Zrectangle ,K \;`P@aefpZrectanglefill ?,K \~;P@G a0Zrnd ,K \o;@,Zstringprint ,K \_;@PZ  PZtab 3,K \N;P@   0Ztint s,K \=;`P@t r p m i g e pZvduq ,0,K \!;LY  P0Z D PP @0D PU 0ZHvpos ,K \;@Zsound ,,K \;(L 8 0{        Zsound_on ,K \;(L A Zsound_off ,K \;(L A Zvoices ,K \;(L 0 0 0 0  Zstereo ,K \;(L  B Zset_beats ,K \j;(L  Zget_beats ,K \W;(L  Zget_beat ,K \A;(L  } Zset_tempo ,K \+;(L  h Zget_tempo ,K \;(L  T Zw_initialise ,K \;@(L O 0P K[ Zcreate_wind ,K \;@(L  0 0P @P Zcreate_icon ,K \;@(L   0P @P Zdelete_wind ,K \;(LJ    J R J00@PZdelete_icon ,K \;@0L   0P @PZopen_wind ,K \d;@(L   P 00CSZclose_wind ,K \G;(LJ   J R J00@PZpoll_wimp ,K \';@(L   o 0P @P Zredraw_wind ,K \;@(L  P 0P @P Zupdate_wind ,K \;@(L  1 0P @P Zget_rectangle ,K \;@(L   0P @P Zget_wind_state ,K \;@(L    0P @PZset_icon_state ,K \;@(L   P 00CSZget_icon_state ,K \i;@(L   P 00CSZget_point_info ,K \K;@(L  A P 00CSZdrag_box ,K \.;@(L  y P 00CSZforce_redraw ,K \;@_ PZ 00@PZset_caret_pos ,K \;@E PZ 00@PZget_caret_pos ,K \;@(L   & P 00CSZcreate_menu ,K \;@(L    0P @PZdecode_menu ,K \;@(L   0P @PZwhich_icon ,K \|;@(L 00 0  P 00@PZset_extent ,K \W;@(L 0   P 00CSZset_point_shape ,K \5;@PZ 00@PZopen_template ,K \;@(L  fP 00CSZclose_template ,K \;@(L K0P K[Zload_template ,K \;@ 0PZ 00@PZ_sysdie ,K \;L  9 MZ*** fatal error in run time system: %.80s_assert_fail ,K \;,0 <PHZ*** assertion failed: %s, file %s, line %d tstrerror ,K \;PZ PZ PZ P"Z -@ZNo error (errno = 0)EDOM - function argument out of rangeERANGE - function result not representableESIGNUM - illegal signal number to signal() or raise()Error code (errno) %d has no associated messagehperror ,K \7;tAP [ Pr PkZ%s: %s a_clock ,K \;L > Z_clock_init ,K \;Z_clock_ignore ,K \;@<0@@0Zclock ,K \;뀰 @Ztime q,K \;Pd@0 PGL 0  K 0S 0FS) @  RB R  [@F Rm n  R   0``LL+ # `+   U{*@VPUpZ pZ_sys_msg ,K \/;``Hp@P0 00 40S 0 @40 Pa4Zt %s   o P] g cZ isttyname :[  t[ t[P_sys_open 3,K \;P@İ AP0ZLT ,0$(,P ,0$(,P0Z_ttywrite ,K \;`pG pP @ P P G pPZ_ttyread ,K \{;@P`p y 0  p0I Y y Y 0Y! Y +[@ZW4 _ ] 0p JEZW% PpG PKW EpG P @WW Y^6@4 1 0p EZremove ,K \;@,0 5PZrename ,KBL [;P`@L?p<P!Z) s o   P̌̌Zrename getenvsystem ,K \;PZ_main ,,K \;@ LP`p+++t4P0T X !t0tQ Q%V'  ` <[ >[ U p P!:tt:tt:tth [ [p ` Q Vd HUڄ  PERUNZ_mapstore ,K \?;{LP`X0T #PvT@XTpP& P0 P^UPPW, Counts from %p to %p %.6x: %-10u P`PE [{Hy}{C P?D @ [ YUP"P"0 D P @YPYY<IP YU Ph P %.6x: %s P P`@\ XTU  PZ _backtrace ,,K \;@Zp P# Postmortem requested P ,0 P Illegal write to address %p = %d (pc=%p) ,0 PT  P@[O1{p`3 Illegal read from address %p = %d (pc=%p) can not be found[ [ [ [ [ ppppp`P `F00c+PaW$ 6,0G p& P_XڼPX   ,0 D PLX PGW5<0SE Arg%d: %#.8x %d -> [%#.8x %#.8x %#.8x %#.8x]  P  P% @TsiZFunction name %s _ignore_signal_handler_default_signal_handler ,K \;dL@[ i!<ES\OeAbnormal termination (e.g. abort() function)OWArithmetic error (division by zero/floating overflow)OGIllegal instruction (call to non-function/code corrupted) [is the floating point emulator installed?]O+Interrupt received from userO!Illegal address (e.g. wildly outside array bounds)OTermination request receivedOStack overflow  @CZUnknown signal number %d_error_signal_marker ,K \5